368346
SPINK6 (Serine Protease Inhibitor Kazal-type 6, BUSI2, UNQ844, Serine Peptidase Inhibitor, Kazal type 6)
Size
£685.00
- SKU:
- 368346
- Purity:
- Purified
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- SPINK6 (AAH32003.1, aa1-80) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 3C10
- Format:
- Supplied as a liquid in PBS, pH 7.4.
- Extra Details:
- SPINK6 (serine peptidase inhibitor, Kazal type 6), also known as BUSI2, is an 80aa secreted protein that contains one kazal-like domain and is thought to function as a serine protease inhibitor. The gene encoding SPINK6 maps to human chromosome 5, which contains 181 million base pairs and comprises nearly 6% of the human genome. Chromosome 5 is associated with Cockayne syndrome through the ERCC8 gene and familial adenomatous polyposis through the adenomatous polyposis coli (APC) tumor suppressor gene. Treacher Collins syndrome is also associated with chromosome 5 and is caused by insertions or deletions within the TCOF1 gene. Deletion of the p arm of chromosome 5 leads to Cri du chat syndrome, while deletion of the q arm or of chromosome 5 altogether is common in therapy-related acute myelogenous leukemias and myelodysplastic syndrome. Applications: Suitable for use in ELISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MKLSGMFLLLSLALFCFLTGVFSQGGQVDCGEFQDTKVYCTRESNPHCGSDGQTYGNKCAFCKAIVKSGGKISLKHPGKC Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice