368281
PDCD1LG2 (Programmed Cell Death 1 Ligand 2, B7DC, Btdc, CD273, PD-L2, PDCD1L2, PDL2)
Size
£685.00
- SKU:
- 368281
- Purity:
- Purified
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- PDCD1LG2 (AAH74766.1, aa19-121) partial recombinant protein with GST tag.
- Clone:
- 6G9
- Format:
- Supplied as a liquid in PBS, pH 7.4.
- Extra Details:
- Programmed cell death 1 ligand 2 (PD-L2, B7-DC, CD273) is a member of the B7 family of cell surface ligands that regulate T-cell activation and immune responses (1,2). PD-L2 binds the PD-1 transmembrane receptor and inhibits T-cell activation. PD-L2 was discovered following a search for novel B7 protein homologs and was later shown to be expressed by activated dendritic cells, macrophages, and T-cells (1,3). Similar in structure to related B7 family members, PD-L2 protein contains extracellular IgV and IgC2 domains, a transmembrane domain, and a short, cytoplasmic region. Research studies demonstrate that PD-L2 is expressed in several tumor types, including lung cancer, renal cell carcinoma, melanoma, Hodgkin’s lymphoma and primary mediastinal large B-cell lymphoma (4-7). Applications: Suitable for use in ELISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: ALFTVTVPKELYIIEHGSNVTLECNFDTGSHVNLGAITASLQKVENDTSPHRERATLLEEQLPLGKASFHIPQVQVRDEGQYQCIIIYGVAWDYKYLTLKVKA Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice