MEF2BNB (MEF2B Neighbor, BORCS8, BLOC-1-related Complex Subunit 8)

Size

£685.00

SKU:: 368246
Purity:: Purified
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: MEF2BNB (AAH04449.1, aa1-109) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1B5
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: As part of the BORC complex may play a role in lysosomes movement and localization at the cell periphery. Associated with the cytosolic face of lysosomes, the BORC complex may recruit ARL8B and couple lysosomes to microtubule plus-end-directed kinesin motor. Applications: Suitable for use in Immunofluorescence, ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MEEPEMQLKGKKVTDKFTESVYVLANEPSVALYRLQEHVRRSLPELAQHKADMQRWEEQSQGAIYTVEYACSAVKNLVDSSVHFRSVEGLLKQAISIRDHMNASAQGHR Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.