KLF10 (Kruppel-like Factor 10, EGRA, TIEG, TIEG1)

Size

£843.00

SKU:: 368192
Purity:: Purified
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: KLF10 (AAH11538.1, aa111-210) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Clone:: 7C1
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: Transcriptional repressor involved in the regulation of cell growth. Inhibits cell growth. Binds to the consensus sequence 5'-GGTGTG-3'. Applications: Suitable for use in ELISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: LSDTAKPHIAAPFKEEEKSPVSAPKLPKAQATSVIRHTADAQLCNHQTCPMKAASILNYQNNSFRRRTHLNVEAARKNIPCAAVSPNRSKCERNTVADVD Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.