CUEDC2 (CUE Domain-containing Protein 2, C10orf66)

Size

£685.00

SKU:: 368087
Purity:: Purified
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: CUEDC2 (NP_076945.1, aa1-226) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2B11
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: CUEDC2 (CUE domain containing 2) is a protein-coding gene. Diseases associated with CUEDC2 include alzheimer's disease, and malaria. Applications: Suitable for use in ELISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MELERIVSAALLAFVQTHLPEADLSGLDEVIFSYVLGVLEDLGPSGPSEENFDMEAFTEMMEAYVPGFAHIPRGTIGDMMQKLSGQLSDARNKENLQPQSSGVQGQVPISPEPLQRPEMLKEETRSSAAAAADTQDEATGAEEELLPGVDVLLEVFPTCSVEQAQWVLAKARGDLEEAVQMLVEGKEEGPAAWEGPNQDLPRRLRGPQKDELKSFILQKYMMVDSA Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.