368049
CD80 (T-lymphocyte Activation Antigen CD80, Activation B7-1 Antigen, CD80 Molecule, CD28LG, CD28LG1, LAB7)
Size
£685.00
- SKU:
- 368049
- Purity:
- Purified
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- CD80 (AAH11399.2, aa137-230) partial recombinant protein with GST tag.
- Clone:
- 6G6
- Format:
- Supplied as a liquid in PBS, pH 7.4.
- Extra Details:
- The B-lymphocyte activation antigen B7-1 (formerly referred to as B7) provides regulatory signals for T lymphocytes as a consequence of binding to the CD28 and CTLA4 ligands of T cells. Applications: Suitable for use in ELISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: SVKADFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLSWLENGEELNAINTTVSQDPETELYAVSSKLDFNMTTNHSF MCLIKYGHLRVNQTFN Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice