CD28 (CD28 Molecule, T-Cell-specific Surface Glycoprotein CD28, Tp44)

Size

£685.00

SKU:: 368039
Purity:: Purified
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: CD28 (NP_006130.1, aa18-152) partial recombinant protein with GST tag.
Clone:: 4B5
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: CD28 costimulation is essential for CD4-positive T-cell proliferation, survival, interleukin-2 production, and T-helper type-2 (Th2) development. Applications: Suitable for use in ELISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: GNKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLG NESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKP Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.