367974
ACP1 (Low Molecular Weight Phosphotyrosine Protein Phosphatase, HAAP, Acid Phosphatase 1, Soluble)
Size
£685.00
- SKU:
- 367974
- Purity:
- Purified
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- ACP1 (AAH07422, aa1-158) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 2A15
- Format:
- Supplied as a liquid in PBS, pH 7.4.
- Extra Details:
- The product of this gene belongs to the phosphotyrosine protein phosphatase family of proteins. It functions as an acid phosphatase and a protein tyrosine phosphatase by hydrolyzing protein tyrosine phosphate to protein tyrosine and orthophosphate. This enzyme also hydrolyzes orthophosphoric monoesters to alcohol and orthophosphate. This gene is genetically polymorphic, and three common alleles segregating at the corresponding locus give rise to six phenotypes. Each allele appears to encode at least two electrophoretically different isozymes, Bf and Bs, which are produced in allele-specific ratios. Multiple alternatively spliced Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISE NWVIDSGAVSDWNVGRSPDPRAVSCLRNHGIHTAHK ARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKA KIELLGSYDPQKQLIIEDPYYGNDSDFETVYQQCVRCC RAFLEKAH Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice