364805
PTHrP (Parathyroid Hormone Related Protein, PTHLH, HHM, PTHR, PLP, Osteostatin, Parathyroid Hormone Like Hormone)
Size
£513.00
- SKU:
- 364805
- Application:
- WB
- Purity:
- Purified by Protein A and peptide affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Rabbit
- Immunogen:
- Recombinant protein corresponding to Ala37-His177 of bovine PTHrP, fused to two N-terminal Tags, His-Tag and S-tag expressed in E. coli.
- Format:
- Supplied as a liquid in PBS, pH 7.4, 0.02% sodium azide, 50% glycerol.
- Extra Details:
- Parathyroid hormone-related protein (or PTHrP) is a protein occasionally secreted by cancer cells (breast cancer, certain types of lung cancer including squamous cell carcinoma). However, it also has normal functions. PTHrP acts as an endocrine, autocrine/ paracrine, and intracrine hormone. PTHrP is related in function to the "normal" parathyroid hormone. When a tumor secretes PTHrP, this can lead to hypercalcemia. As this is sometimes the first sign of the malignancy, hypercalcemia caused by PTHrP is considered a paraneoplastic phenomenon. PTHrP shares the same N-terminal end as parathyroid hormone and therefore it can bind to the same receptor (the Type I PTH receptor). PTHrP aids in normal mammary gland development and lactation as well as placental transfer of calcium. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-AVSE HQLLHDKGKS IQDLRRRFFL HHLIAEIHTA EIRATSEVSP NSKPAPNTKN HPVRFGSDDE GKYLTQETNK VETYKEQPLK TPGKKKKSKP GKRKEQEKKK RRTRSAWLTS YVAGTGLEED YLSDISATSL ELNSRRH Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice