Brain Natriuretic Peptide (BNP), Recombinant, Human

Size

£654.00

SKU:: 359894
Molecular Weight:: 3.5
Purity:: ≥97% (SDS-PAGE, HPLC). Endotoxin: ≤1EU/mg (LAL)
Storage Conditions:: -20°C
Supplier:: United States Biological
Format:: Supplied as a lyophilized powder from PBS, pH 7.4. Reconstitute with sterile dH2O, 0.1% BSA to 0.1-1mg/ml.
Extra Details:: Recombinant protein corresponding to human Brain Natriuretic Peptide (BNP), a single non-glycosylated polypeptide chain containing 32aa, expressed in E. coli. Molecular Weight: ~3.5kD (32aa) Applications: Suitable for use in SDS-PAGE. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O, 0.1% BSA. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.