353303
TAP2 (Antigen Peptide Transporter 2, ABC Transporter, MHC 2, ABCB3, APT2, Peptide Transporter PSF2, Peptide Transporter TAP2, Psf2 PSF-2, RING11, SEC14L3, TAP 2)
Size
£620.00
- SKU:
- 353303
- Application:
- WB
- Purity:
- Purified by immunoaffinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide corresponding to aa611-651, QKQRLAIARALVRDPRVLILDEATSALDVQCEQALQDWNSR, of human TAP2 at C-terminal, different from the related mouse sequence by 5aa, and from the related rat sequence by 6aa.
- Format:
- Supplied as a lyophilized powder in 5mg BSA, 0.9mg sodium chloride, 0.2mg Na2HPO4, 0.05mg sodium azide. Reconstitute with 200ul sterile dH2O to ~0.5mg/ml.
- Extra Details:
- Transporter, ATP-binding cassette, major histocompatibility complex 2 (TAP2) is a gene in humans that encodes the protein Antigen peptide transporter 2. The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. The gene is assigned to human chromosome 6p21.3. It is located 7 kb telomeric to gene family member ABCB2. The protein encoded by this gene is involved in antigen presentation. And this protein forms a heterodimer with ABCB2 in order to transport peptides from the cytoplasm to the endoplasmic reticulum. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Western Blot: 0.1-0.5ug/ml Optimal dilutions to be determined by the researcher. Storage and Stability: Lyophilized powder may be stored at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
- Shipping Conditions:
- Blue Ice