350754
NDRG2, CT (NDRG family member 2, KIAA1248)
Size
£620.00
- SKU:
- 350754
- Purity:
- Purified by immunoaffinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide corresponding to aa210-247, NSELIQKYRNIITHAPNLDNIELYWNSYNNRRDLNF -ER, of human NDRG2 at C-terminal.
- Format:
- Supplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O.
- Extra Details:
- Protein NDRG2, also known as KIAA1248, is a protein that in humans is encoded by the NDRG2 gene. It is a member of the N-myc downregulated gene family which belongs to the alpha/beta hydrolase superfamily. This gene is mapped to 14q11.2. The protein encoded by this gene is a cytoplasmic protein that may play a role in neurite outgrowth. This gene may be involved in glioblastoma carcinogenesis. It contributes to the regulation of the WNT signaling pathway. Also, this gene may be involved in dendritic cell and neuron differentiation. Applications: Suitable for use in Western Blot, Immunohistochemistry. Other applications not tested. Recommended Dilution: Western Blot: 0.1-0.5ug/ml Immunohistochemistry (paraffin): 0.5-1ug/ml Optimal dilutions to be determined by the researcher. Storage and Stability: Lyophilized and reconstituted products are stable for 12 months after receipt at -20°C. Reconstitute with sterile dH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
- Shipping Conditions:
- Blue Ice