350695
ITGA4, CT (CD49 antigen-like family member D, Integrin alpha-IV, VLA-4 subunit alpha, CD49d)
Size
£620.00
- SKU:
- 350695
- Purity:
- Purified by immunoaffinity chromatography
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide corresponding to aa999-1028, MWKAGFFKRQYKSILQEENRRDSWSYINSK, at the C-Terminal of human Integrin alpha 4, different from the related mouse sequence by one amino acid
- Format:
- Supplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O.
- Extra Details:
- ITGA4/Integrin alpha4 is an integrin alpha subunit. It makes up half of the a4B1 lymphocyte homing receptor. The product of this gene belongs to the integrin alpha chain family of proteins. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. This gene encodes an alpha 4 chain. Unlike other integrin alpha chains, alpha 4 neither contains an I-domain, nor undergoes disulfide-linked cleavage. Alpha 4 chain associates with either beta 1 chain or beta 7 chain. ITGA4 is also mapped to 2q31-q32 by fluorescence in situ hybridization. Applications: Suitable for use in Western Blot, Immunohistochemistry and Flow Cytometry. Other applications not tested. Recommended Dilutions: Western Blot: 0.1-0.5ug/ml Immunohistochemistry (Paraffin/Frozen): 0.5-1ug/ml. Boiling the paraffin sections in 10mM citrate buffer, pH 6.0, for 20 minutes is required for staining formalin/parffin sections. Flow Cytometry: 1-3ug/1x10e6 cells Optimal dilutions to be determined by the researcher. Storage and Stability: Lyophilized and reconstituted products are stable for 12 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
- Shipping Conditions:
- Blue Ice