302006

Insulin-Like 4 (INSL-4, RLF)

Size

£1,075.00

SKU:: 302006
Purity:: Purified
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Rabbit
Format:: Supplied as a lyophilized powder. Reconstitute with 50ul sterile ddH2O.
Extra Details:: Insulin-like protein (INSL3, INSL4, INSL5, INSL6 & INSL7/H3 Relaxin) belongs to the insulin-like hormone superfamily, which encompasses insulin, relaxin, and insulin-like growth factors I (IGF1) and II (IGF2). Insulin gene superfamily hormones regulate cell growth, metabolism, and tissue-specific functions. Applications: Suitable for use in Indirect ELISA, Immunohistochemistry. Other applications not tested. Recommended Dilution: Indirect ELISA: 1:6400 Immunohistochemistry: 1:1000-2000 Optimal dilutions to be determined by the researcher. Sequence: A Chain SGRHRFDPFCCEVICDDGTSVKLCT, B Chain ELLRESLAAELRGCGPRFGKHLLSYCPMPEKTFTTTPGGWL Storage and Stability: Lyophilized powder may be stored at -20°C. Stable for 12 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Reconstituted product is stable for 12 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.