Toxoplasma gondii, P24 (GRA1), Recombinant

Size

£409.00

SKU:: 301552
Purity:: ≥90% (SDS-PAGE)
Storage Conditions:: -20°C
Supplier:: United States Biological
Format:: Supplied as a liquid in 20mM Tris-HCl, pH 7.2, 1.5M Urea, 50% glycerol.
Extra Details:: Immunoreactive with sera from Toxoplasma gondii -infected individuals with minimum specificity problems. Recombinant protein corresponding to immunodominant regions aa57-149 of Toxoplasma gondii p24 (GRA1), expressed in E. coli. Amino Acid Sequence: MGAYAAEGGDNQSSAVSDRASLFGLLSGGTGQGLGIGESVDLEMMGNTYRVERPTG NPDLLKIAIKASDGSYSEVGNVNVEEVIDTMKSMQRDEDIFLRALNKGETVEEAIEDVAQ AEGLNSEQTLQLEDAVSAVASVVQDEMKVIDDVQQLEKDKQQLKDDIGFLTGEREHHHHH H Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing.. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.