WDR9 (BD2), Recombinant, Human, aa1308-1436, GST-tag (Bromodomain and WD Repeat Domain Containing 1, BRWD1, WD Repeat-Containing Protein 9)

Size

£849.00

SKU:: 298491
Molecular Weight:: 42
Purity:: Highly Purified (~90%)
Storage Conditions:: -70°C
Supplier:: United States Biological
Format:: Supplied as a liquid in 40mM Tris-HCl, pH 8.0, 110mM sodium chloride, 2.2mM KCl, 0.04% Tween 20, 20% glycerol.
Extra Details:: Source: Recombinant protein corresponding to bromodomain 2, aa1308-1436, from human WDR9, fused to GST-tag at N-terminal, expressed in E. coli. Molecular Weight: ~42kD AA Sequence: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYI DGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLK VDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLV CFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSIRATN YVESNWKKQCKELVNLIFQCEDSEPFRQPVDLVEYPDYRDIIDTPMDFGTVRETLDAG NYDSPLEFCKDIRLIFSNAKAYTPNKRSKIYSMTLRLSALFEEKMKKISSDFKIGQKFNE KLRRSQ Applications: Suitable for use in the study of bromodomain binding assays, screening inhibitors, and selectivity profiling. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.