CBX2, Recombinant, Human, aa2-90, GST-tag (Chromobox Homolog 2, SRXY5, Cell Division Cycle Associated 6, CDCA6)

Size

£1,079.00

SKU:: 298386
Molecular Weight:: 37.3
Purity:: Purified (~79%)
Storage Conditions:: -70°C
Supplier:: United States Biological
Format:: Supplied as a liquid in 40mM Tris-HCl, pH 8.0, 110mM sodium chloride, 2.2mM potassium chloride, 16mM glutathione, 20% glycerol.
Extra Details:: Component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones; it mediates monoubiquitination of histone H2A Lys119, rendering chromatin heritably changed in its expressibility. Involved in sexual development, acting as activator of NR5A1 expression. Source: Recombinant protein corresponding to aa2-90 from human chromobox homolog 2, fused to GST-tag at N-terminal, expressed in E. coli. Molecular Weight: ~37.3kD AA Sequence: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYI DGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLK VDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLV CFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSEELSS VGEQVFAAECILSKRLRKGKLEYLVKWRGWSSKHNSWEPEENILDPRLLLAFQKKEH EKEVQNRKRGKRPRGRPRKLTAMSSCS Applications: Suitable for use in protein binding assays, screening inhibitors, and selectivity profiling. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Shipping Conditions:: Dry Ice