TIP 39, Human, aa62-100 (Tuberoinfundibular Peptide of 39 Residues)

Size

£368.00

SKU:: 298303
Purity:: ≥95% (HPLC)
Storage Conditions:: -20°C
Supplier:: United States Biological
Format:: Supplied as a lyophilized powder. Reconstitute with 0.1% acetic acid.
Extra Details:: Plays a role as a potent and selective agonist of PTH2R resulting in adenyl cyclase activation and intracellular calcium levels elevation. Induces protein kinase C beta activation, recruitment of beta-arrestin and PTH2R internalization. May inhibit cell proliferation via its action on PTH2R activation. Neuropeptide which may also have a role in spermatogenesis. May activate nociceptors and nociceptive circuits. Source: Synthetic human TIP 39 Amino Acid Sequence: SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile 0.1% acetic acid. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.