Parathyroid Hormone, Rat, aa1-34 (PTH, Parathyrin)

Size

£384.00

SKU:: 298235
Purity:: ≥95% (HPLC)
Storage Conditions:: -20°C
Supplier:: United States Biological
Format:: Supplied as a lyophilized powder. Reconstitute with 0.1% acetic acid.
Extra Details:: PTH elevates calcium level by dissolving the salts in bone and preventing their renal excretion. Stimulates [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblastic cells (By similarity). Source: Synthetic rat PTH AA Sequence: AVSEIQLMHNLGKHLASVERMQWLRKKLQDVHNF Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile acetic acid. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.