Parathyroid Hormone, Human, aa1-34 (PTH)

Size

£384.00

SKU:: 298232
Molecular Weight:: 4.12
Purity:: ≥95% (HPLC)
Storage Conditions:: -20°C
Supplier:: United States Biological
Format:: Supplied as a lyophilized powder. Reconstitute with 0.1% acetic acid.
Extra Details:: The protein encoded by this gene is a hormone secreted by parathyroid cells. This hormone elevates blood Ca2+ level by dissolving the salts in bone and preventing their renal excretion. Defects in this gene are a cause of familial isolated hypoparathyroidism (FIH). [provided by RefSeq, Jul 2008] Source: Synthetic human Parathyroid Hormone AA Sequence: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile acetic acid. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.