Glucagon Like Peptide-2, Human (GLP-2)

Size

£384.00

SKU:: 298174
Purity:: ≥90% (HPLC)
Storage Conditions:: -20°C
Supplier:: United States Biological
Format:: Supplied as a lyophilized powder. Reconstitute with 0.1% acetic acid.
Extra Details:: Glucagon plays a key role in glucose metabolism and homeostasis. Regulates blood glucose by increasing gluconeogenesis and decreasing glycolysis. A counterregulatory hormone of insulin, raises plasma glucose levels in response to insulin-induced hypoglycemia. Plays an important role in initiating and maintaining hyperglycemic conditions in diabetes. Source: Synthetic human Glucagon Like Peptide-2. Uniprot/Accession: P01275 Amino Acid Sequence: HADGSFSDEMNTILDNLAARDFINWLIQTKITD Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile acetic acid. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.