ZNF659 (Zinc Finger Protein 385D, FLJ22419, ZNF659)

Size

£685.00

SKU:: 253856
Purity:: Ascites
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: ZNF659 (NP_078973, 1aa-395aa) full-length human protein.
Format:: Supplied as a liquid. No preservative added.
Extra Details:: Mouse polyclonal antibody raised against a full-length human ZNF659 protein. Applications: Suitable for use in Immunofluorescence, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MRNIMYFGGTCQSPALPALVRPPAPPLQPSLDIKPFLPFPLDTMouse polyclonal antibody raised against a full-length human ZNF659 protein.VNLFPNFNAMDPIQKAVINHTFGVPLPHRRKQIISCNICQLRFNSDSQMouse polyclonal antibody raised against a full-length human ZNF659 protein.HYKGTKHAKKLKALEAMKNKQKSVTAKDSAKTTFTSITTNTINTSSDKTDGTAGTPAISTTTTVEIRKSSVMTTEITSKVEKSPTTATGNSSCPSTETEEEKAKRLLYCSLCKVAVNSASQLEAHNSGTKHKTMLEARNGSGTIKAFPRAGVKGKGPVNKGNTGLQNKTFHCEICDVHVNSETQLKQHISSRRHKDRAAGKPPKPKYSPYNKLQKTAHPLGVKLVFSKEPSKPLAPRILPNPLMouse polyclonal antibody raised against a full-length human ZNF659 protein.Mouse polyclonal antibody raised against a full-length human ZNF659 protein.AAVAVSSPFSLRTAPAATLFQTSALPPALLRPAPGPIRTAHTPVLFAPY Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.