253560-APC

ZBTB7B (Zinc Finger and BTB Domain Containing 7B, DKFZp686G01254, THPOK, ZBTB15, ZFP67, ZNF857B, c-Krox, hcKrox) (APC)

Size

£914.00

SKU:: 253560-APC
Purity:: Purified
Storage Conditions:: 4°C Do Not Freeze
Supplier:: United States Biological
Host:: Mouse
Immunogen:: ZBTB7B (NP_056956.1, 433aa-537aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1D4
Format:: Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
Extra Details:: ZFP67 is an early growth response gene that encodes a zinc finger-containing transcription factor that binds to the promoter regions of type I collagen genes (e.g., COL1A1; MIM 120150) and has a role in development.[supplied by OMIM Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: HLCHRAFAKEDHLQRHLKGQNCLEVRTRRRRKDDAPPHYPPPSTMouse monoclonal antibody raised against a partial recombinant ZBTB7B.FPAGLDLSNGHLDTFRLSLARFWEQSAPTWAPVSTPGPPDDDEEEGAPTTPQAEGAME Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.