YAP1 (Yes-Associated Protein 1, 65kD, YAP, YAP2, YAP65, YKI)

Size

£685.00

SKU:: 253500
Purity:: Purified
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa53-161 from human YAP1. MW of the GST tag alone is 26kD.
Clone:: 2H1
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: This gene encodes the human ortholog of chicken YAP protein which binds to the SH3 domain of the Yes proto-oncogene product. This protein contains a WW domain that is found in various structural, regulatory and signaling molecules in yeast, nematode, and mammals, and may be involved in protein-protein interaction. [provided by RefSeq Applications: Suitable for use in ELISA, Immunofluorescence, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry: Formalin fixed paraffin embedded. Optimal dilutions to be determined by the researcher. AA Sequence: QIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLR Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.