XPA (Xeroderma Pigmentosum, Complementation Group A, XP1, XPAC)

Size

£685.00

SKU:: 253484
Purity:: Purified
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: XPA (NP_000371.1, 1aa-273aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Clone:: 20000
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: This gene encodes a zinc finger protein involved in DNA excision repair. The encoded protein is part of the NER (nucleotide excision repair) complext which is responsible for repair of UV radiation-induced photoproducts and DNA adducts induced by chemical carcinogens. Mutations in this gene are associated with xeroderma pigmentosum complementation group A. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq Applications: Suitable for use in Immunofluorescence, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MMouse monoclonal antibody raised against a full-length recombinant XPA.DGALPEMouse monoclonal antibody raised against a full-length recombinant XPA.LEQPAELPASVRASIERKRQRALMLRQARLAARPYSATMouse monoclonal antibody raised against a full-length recombinant XPA.ATGGMANVKAAPKIIDTGGGFILEEEEEEEQKIGKVVHQPGPVMEFDYVICEECGKEFMDSYLMNHFDLPTCDNCRDADDKHKLITKTEAKQEYLLKDCDLEKREPPLKFIVKKNPHHSQWGDMKLYLKLQIVKRSLEVWGSQEALEEAKEVRQENREKMKQKKFDKKVKELRRAVRSSVWKRETIVHQHEYGPEENLEDDMYRKTCTMCGHELTYEKM Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Shipping Conditions:: Blue Ice