UBE2Z (Ubiquitin-conjugating Enzyme E2Z, FLJ13855, HOYS7, USE1)

Size

£685.00

SKU:: 253223
Purity:: Purified
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: UBE2Z (NP_075567, 136aa-225aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Clone:: 4B1
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: Modification of proteins with ubiquitin (UBB; MIM 191339) or ubiquitin-like proteins controls many signaling networks and requires a ubiquitin activating enzyme (E1), a ubiquitin conjugating enzyme (E2), and a ubiquitin protein ligase (E3). UBE2Z is an E2 enzyme (Jin et al., 2007 [PubMed 17597759]).[supplied by OMIM Applications: Suitable for use in Immunofluorescence, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: IRHETIRVAVCDMMEGKCPCPEPLRGVMEKSFLEYYDFYEVACKDRLHLQGQTMQDPFGEKRGHFDYQSLLMRLGLIRQKVLERLHNENA Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.