TSSK1 (Testis-Specific Serine Kinase 1B, FKSG81, SPOGA4, STK22D, TSSK1)

Size

£685.00

SKU:: 253069
Purity:: Purified
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: TSSK1 (AAH22515, 267aa-367aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Clone:: 4F12
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: TSSK1 belongs to a family of serine/threonine kinases highly expressed in testis (Hao et al., 2004 [PubMed 15044604]).[supplied by OMIM Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: LSHCWMQPKARGSPSVAINKEGESSRGTEPLWTPEPGSDKKSATKLEPEGEAQPQAQPETKPEGTAMQMSRQSEILGFPSKPSTMETEEGPPQQPPETRAQ Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.