TOPBP1 (Topoisomerase (DNA) II Binding Protein 1, TOP2BP1)

Size

£685.00

SKU:: 252889
Purity:: Purified
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: TOPBP1 (NP_008958, 1327aa-1435aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Clone:: 6D12
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: This gene encodes a binding protein which interacts with the C-terminal region of topoisomerase II beta. This interaction suggests a supportive role for this protein in the catalytic reactions of topoisomerase II beta through transient breakages of DNA strands. [provided by RefSeq Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: LLQSGGAKVLPGHSVPLFKEATHLFSDLNKLKPDDSGVNIAEMouse monoclonal antibody raised against a partial recombinant TOPBP1.QNVYCLRTEYIADYLMQESPPHVENYCLPEAISFIQNNKELGTGLSQKRKAPTEKNKIKRPRVH Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.