TJAP1 (Tight Junction Associated Protein 1 (peripheral), DKFZp686F06131, PILT, TJP4)

Size

£685.00

SKU:: 252685
Purity:: Purified
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: TJAP1 (NP_542171.1, 77aa-180aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Clone:: 200000
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: This gene encodes a tight junction-associated protein. Incorporation of the encoded protein into tight junctions occurs at a late stage of formation of the junctions. The encoded protein localizes to the Golgi and may function in vesicle trafficking. Alternatively spliced transcript variants have been described. A related pseudogene exists on the X chromosome. [provided by RefSeq Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: LELELGQSREELDKFKDKFRRLQNSYTASQRTNQELEDKLHTLIKKAEMDRKTLDWEIVELTNKLLDAKNTINKLEELNERYRLDCNPAVQLLKCNKSHFRNHK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.