THRAP6 (Mediator Complex Subunit 30, MGC9890, THRAP6, TRAP25)

Size

£685.00

SKU:: 252635
Application:: WB
Purity:: Ascites
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: THRAP6 (NP_542382.1, 1aa-178aa) full-length human protein.
Format:: Supplied as a liquid. No preservative added.
Extra Details:: The multiprotein TRAP/Mediator complex facilitates gene expression through a wide variety of transcriptional activators. THRAP6 is a component of this complex that appears to be metazoan specific Baek et al. (2002) [PubMed 11909976].[supplied by OMIM Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MSTPPLAASGMAPGPFAGPQAQQAAREVNTASLCRIGQETVQDIVYRTMEIFQLLRNMQLPNGVTYHTGTYQDRLTKLQDNLRQLSVLFRKLRLVYDKCNENCGGMDPIPVEQLIPYVEEDGSKNDDRAGPPRFASEERREIAEVNKKLKQKNQQLKQIMDQLRNLIWDINAMLAMRN Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.