252568-BIOTIN

TFDP3 (Transcription Factor Dp Family, Member 3, CT30, E2F-like, HCA661, MGC161639) (Biotin)

Size

£914.00

SKU:: 252568-BIOTIN
Purity:: Purified
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: TFDP3 (NP_057605, 1aa-100aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3F11
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Extra Details:: TFDP3 is a member of the DP family of proteins, which form heterodimers with E2F proteins (see E2F1; MIM 189971) and regulate transcription (Qiao et al., 2007 [PubMed 17062573]).[supplied by OMIM Applications: Suitable for use in ELISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MPQRPAASNIPVVGSPNPPSTHFASQNQHSYSSPPWAGQHNRKGEKNGMGLCRLSMKVWETVQRKGTTSCQEVVGELVAKFRAASNHASPNESAYDVKNI Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.