TCIRG1 (T-Cell, immune Regulator 1, ATPase, H+ Transporting, Lysosomal V0 Subunit A3, ATP6N1C, ATP6V0A3, Atp6i, OC-116kD, OC116, OPTB1, Stv1, TIRC7, Vph1, a3)

Size

£698.00

SKU:: 252492
Purity:: Ascites
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: TCIRG1 (AAH18133, 121aa-220aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Clone:: 6H3
Format:: Supplied as a liquid.
Extra Details:: Through alternate splicing, this gene encodes two proteins with similarity to subunits of the vacuolar ATPase (V-ATPase) but the encoded proteins seem to have different functions. V-ATPase is a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, and receptor-mediated endocytosis. V-ATPase is comprised of a cytosolic V1 domain and a transmembrane V0 domain. Mutations in this gene are associated with infantile malignant osteopetrosis. [provided by RefSeq Applications: Suitable for use in ELISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: QLHQLQLHAAVLRQGHEPQLMouse monoclonal antibody raised against a partial recombinant TCIRG1.HTDGASERTPLLQAPGGPHQDLRVNFVAGAVEPHKAPALERLLWRACRGFLIASFRELEQPLEHPVTGEPATWMTFL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Shipping Conditions:: Blue Ice