252422-BIOTIN
TBL1XR1 (Transducin (beta)-like 1 X-Linked Receptor 1, C21, DC42, FLJ12894, IRA1, TBLR1) (Biotin)
Size
£914.00
- SKU:
- 252422-BIOTIN
- Purity:
- Purified
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- TBL1XR1 (NP_071347, 81aa-178aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 400
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Extra Details:
- The protein encoded by this gene has sequence similarity with members of the WD40 repeat-containing protein family. The WD40 group is a large family of proteins, which appear to have a regulatory function. It is believed that the WD40 repeats mediate protein-protein interactions and members of the family are involved in signal transduction, RNA processing, gene regulation, vesicular trafficking, cytoskeletal assembly and may play a role in the control of cytotypic differentiation. [provided by RefSeq Applications: Suitable for use in Immunofluorescence, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: LSLIDAVMPDVVQTRQQAYRDKLAQQQMouse monoclonal antibody raised against a partial recombinant TBL1XR1.Mouse monoclonal antibody raised against a partial recombinant TBL1XR1.Mouse monoclonal antibody raised against a partial recombinant TBL1XR1.AASQQGSAKNGENTANGEENGAHTIANNHTDMMEVDGDVEIPPNKAVVLRGHESEVFICAWN Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice