252321
SYNJ2 (Synaptojanin 2, INPP5H, KIAA0348, MGC44422)
Size
£685.00
- SKU:
- 252321
- Purity:
- Purified
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- SYNJ2 (NP_003889, 1396aa-1495aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 2B11
- Format:
- Supplied as a liquid in PBS, pH 7.4.
- Extra Details:
- Synaptojanin-2 is a ubiquitously expressed inositol polyphosphate 5-phosphatase (Malecz et al., 2000 [PubMed 11084340]).[supplied by OMIM Applications: Suitable for use in ELISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: GTKAMKPEAAPLLGDYQDPFWNLLHHPKLLNNTWLSKSSDPLDSGTRSPKRDPIDPVSAGASAAKAELPPDHEHKTLGHWVTISDQEKRTALQVFDPLAK Storage and Stability: May be stored at 4°C. For long-term storage, aliquot and store at 4°C. Do not freeze. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Further dilutions can be made in assay buffer.
- Shipping Conditions:
- Blue Ice