SYCE1 (Synaptonemal Complex Central Element Protein 1, C10orf94, RP11-108K14.6, bA108K14.6)

Size

£685.00

SKU:: 252304
Purity:: Purified
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: SYCE1 (NP_963858.1, 1aa-190aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Clone:: 6G7
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: Mouse monoclonal antibody raised against a full-length recombinant SYCE1. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MLQECKERISALNLQIEEEKNKQRQLRLAFEEQLEDLMGQHKDLWDFHMPERLAKEICALDSSKEQLLKEEKLVKATLEDVKHQLCSLCGAEGPSTLDEGLFLRSQEMouse monoclonal antibody raised against a full-length recombinant SYCE1.TVQLFQEEHRKAEELLMouse monoclonal antibody raised against a full-length recombinant SYCE1.AQRHQQLQQKCQQQQQKRQRLKEELEKHGMQVPAQAQSTQEEEAGPGDVAPRPGRPVTWWS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.