251977
SOX21 (SRY (Sex Determining Region Y)-Box 21, SOX25)
Size
£685.00
- SKU:
- 251977
- Purity:
- Purified
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- SOX21 (NP_009015, 91aa-184aa) full length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 3H4
- Format:
- Supplied as a liquid in PBS, pH 7.4.
- Extra Details:
- SRY-related HMG-box (SOX) genes encode a family of DNA-binding proteins containing a 79-amino acid HMG (high mobility group) domain that shares at least 50% sequence identity with the DNA-binding HMG box of the SRY protein (MIM 480000). SOX proteins are divided into 6 subgroups based on sequence similarity within and outside of the HMG domain. For additional background information on SOX genes, see SOX1 (MIM 602148).[supplied by OMIM Applications: Suitable for use in ELISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: KFAFPVPYGLGGVADAEHPALKAGAGLHAGAGGGLVPESLLANPEKMouse monoclonal antibody raised against a full length recombinant SOX21.Mouse monoclonal antibody raised against a full length recombinant SOX21.Mouse monoclonal antibody raised against a full length recombinant SOX21.ARVFFPQSMouse monoclonal antibody raised against a full length recombinant SOX21.Mouse monoclonal antibody raised against a full length recombinant SOX21.Mouse monoclonal antibody raised against a full length recombinant SOX21.Mouse monoclonal antibody raised against a full length recombinant SOX21.AGSPYSLLDLGSKMAEISS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice