SLC3A1 (Solute Carrier Family 3 (cystine, dibasic and Neutral amino Acid Transporters, Activator of cystine, dibasic and Neutral amino Acid Transport), Member 1, ATR1, CSNU1, D2H, FLJ34681, NBAT, RBAT)

Size

£685.00

SKU:: 251754
Purity:: Purified
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: SLC3A1 (AAH22386, 211aa-320aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3G3
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: This gene encodes a type II membrane glycoprotein which is one of the components of the renal amino acid transporter which transports neutral and basic amino acids in the renal tubule and intestinal tract. Mutations and deletions in this gene are associated with cystinuria. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. [provided by RefSeq. Applications: Suitable for use in Immunofluorescence, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: FIPNHTSDKHIWFQLSRTRTGKYTDYYIWHDCTHENGKTIPPNNWLSVYGNSSWHFDEVRNQCYFHQFMKEQPDLNFRNPDVQEEIKEILRFWLTKGVDGFSLDAVKFLL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.