SLC37A4 (Solute Carrier Family 37 (Glucose-6-Phosphate Transporter), Member 4, G6PT1, G6PT2, G6PT3, GSD1b, GSD1c, GSD1d, MGC15729, PRO0685, TRG19)

Size

£685.00

SKU:: 251750
Purity:: Purified
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: SLC37A4 (NP_001458.1, 28aa-76aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Clone:: 7B9
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: This gene regulates glucose-6-phosphate transport from the cytoplasm to the lumen of the endoplasmic reticulum, in order to maintain glucose homeostasis. It also plays a role in ATP-mediated calcium sequestration in the lumen of the endoplasmic reticulum. Mutations in this gene have been associated with various forms of glycogen storage disease. Alternative splicing in this gene results in multiple transcript variants Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: RKTFSFVMPSLVEEIPLDKDDLGFITSSQSAAYAISKFVSGVLSDQMSA Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.