251749-APC

SLC36A2 (Solute Carrier Family 36 (Proton/amino Acid symporter), Member 2, FLJ16051, MGC119658, MGC119660, PAT2, TRAMD1) (APC)

Size

£914.00

SKU:: 251749-APC
Purity:: Purified
Storage Conditions:: 4°C Do Not Freeze
Supplier:: United States Biological
Host:: Mouse
Immunogen:: SLC36A2 (NP_861441, 1aa-71aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2B7
Format:: Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant SLC36A2. Applications: Suitable for use in FLISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MSVTKSTEGPQGAVAIKLDLMSPPESAKKLENKDSTFLDESPSESAGLKKTKGITVFQALIHLVKGNMGTG Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.