SLC30A5 (Solute Carrier Family 30 (Zinc Transporter), Member 5, FLJ12496, FLJ12756, MGC5499, ZNT5, ZNTL1, ZTL1, ZnT-5)

Size

£685.00

SKU:: 251743
Purity:: Purified
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: SLC30A5 (AAH00808.1, 1aa-118aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2.0e+10
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: Mouse monoclonal antibody raised against a full-length recombinant SLC30A5. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MEEKYGGDVLAGPGGGGGLGPVDVPSARLTKYIVLLCFTKFLKAVGLFESYDLLKAVHIVQFIFILKLGTAFFMVLFQKPFSSGKTITKHQIIGSLKIPGRKEFKDKKLNDPRKLVGN Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.