251707-PE

SLC11A2 (Solute Carrier Family 11 (Proton-Coupled Divalent Metal Ion Transporters), Member 2, DCT1, DMT1, FLJ37416, NRAMP2) (PE)

Size

£914.00

SKU:: 251707-PE
Purity:: Purified
Storage Conditions:: 4°C Do Not Freeze
Supplier:: United States Biological
Host:: Mouse
Immunogen:: SLC11A2 (NP_000608, 1aa-65aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2F7
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Extra Details:: The SLC11A2 gene encodes a divalent metal transporter (DMT1), which carries iron, manganese, cobalt, nickel, cadmium, lead, copper, and zinc. DMT1 participates in cellular iron absorption at the luminal surface of the duodenum as well as in other areas of the body (Hubert and Hentze, 2002 [PubMed 12209011]; Ludwiczek et al., 2007 [PubMed 17293870]).[supplied by OMIM. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MVLGPEQKMSDDSVSGDHGESASLGNINPAYSNPSLSQSPGDSEEYFATYFNEKISIPEEEYSCF Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.