251635
SH3GL2 (SH3-Domain GRB2-like 2, CNSA2, EEN-B1, FLJ20276, FLJ25015, SH3D2A, SH3P4)
Size
£685.00
- SKU:
- 251635
- Purity:
- Purified
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- SH3GL2 (NP_003017, 64aa-124aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 2G6
- Format:
- Supplied as a liquid in PBS, pH 7.4.
- Extra Details:
- Mouse monoclonal antibody raised against a partial recombinant SH3GL2. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: SRAKLSMINTMSKIRGQEKGPGYPQAEALLAEAMLKFGRELGDDCNFGPALGEVGEAMREL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice