SEC24A (SEC24 Family, Member A (S. cerevisiae))

Size

£685.00

SKU:: 251479
Purity:: Purified
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: SEC24A (XP_094581.5, 301aa-390aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Clone:: 4D9
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: In yeast, the Sec23-Sec24 complex is a component of coat protein II (COPII)-coated vesicles that mediate protein transport from the endoplasmic reticulum. SEC24A is 1 of several mammalian proteins that show structural and functional homology to yeast Sec24.[supplied by OMIM Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: PLTSSYRDVPQPLFNSAVNQEGITSNTNNGSMVVHSSYDEIEGGGLLATPQLTNKNPKMSRSVGYSYPSLPPGYQNTTPPGATGVPPSSL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.