SCAND2 (SCAN Domain Containing 2 Pseudogene)

Size

£685.00

SKU:: 251443
Purity:: Purified
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: SCAND2 (NP_071333, 1aa-62aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Clone:: 5F1
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: The SCAN domain is a highly conserved, leucine-rich motif of approximately 60 aa originally found within a subfamily of zinc finger proteins. This gene belongs to a family of genes that encode an isolated SCAN domain, but no zinc finger motif. Functional studies have established that the SCAN box is a protein interaction domain that mediates both hetero- and homoprotein associations, and maybe involved in regulation of transcriptional activity. Multiple transcript variants which encode the same isoform but differ only in their 3' UTRs, and another variant which encodes a distinct isoform have been described for this gene. Applications: Suitable for use in Immunofluorescence, ELISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MAVAVDQQIQTPSVQDLQIVKLEEDSHWEQEISLQGNYPGPETSCQSFWHFRYQEASRPREA Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.