RBCK1 (RanBP-Type and C3HC4-Type Zinc Finger Containing 1, C20orf18, HOIL1, RBCK2, RNF54, UBCE7IP3, XAP3, XAP4, ZRANB4)

Size

£685.00

SKU:: 250929
Purity:: Purified
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: RBCK1 (NP_006453, 3aa-99aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1B7
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: The protein encoded by this gene is similar to mouse UIP28/UbcM4 interacting protein. Alternative splicing has been observed at this locus, resulting in distinct isoforms. [provided by RefSeq Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: TATPDGREDQERLWVSVEDAQMHTVTIWLTVRPDMTVASLKDMVFLDYGFPPVLQQWVIGQRLARDQETLHSHGVRQNGDSAYLYLLSARNTSLNPQ Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.