RANGRF (RAN Guanine Nucleotide Release Factor, DKFZp686F02139, HSPC165, HSPC236, MGC110973, MOG1, RANGNRF)

Size

£685.00

SKU:: 250865
Purity:: Purified
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: RANGRF (AAI00018.1, 1aa-146aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1H4
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: Mouse monoclonal antibody raised against a full-length recombinant RANGRF. Applications: Suitable for use in Immunofluorescence, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MEPTRDCPLFGGAFSAILPMGAIDVSDLRPVPDNQEVFCHPVTDQSLIVELLELQAHVRGEMouse monoclonal antibody raised against a full-length recombinant RANGRF.RYHFEDVGGVQGARAVHVESVQPLSLENLALRGRCQEAWVLSGKQQIAKENQQVAKDVTLHQALLRLPQYQTDLLLTFNQPP Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.