PSMB8 (Proteasome (Prosome, Macropain) Subunit, beta Type, 8 (Large multifunctional Peptidase 7), D6S216, D6S216E, LMP7, MGC1491, PSMB5i, RING10, beta5i)

Size

£685.00

SKU:: 250583
Purity:: Purified
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: PSMB8 (AAH01114, 173aa-272aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2F4
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant PSMB8. Applications: Suitable for use in Immunofluorescence, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: DKKGPGLYYVDEHGTRLSGNMFSTGSGNTYAYGVMDSGYRPNLSPEEAYDLGRRAIAYATHRDSYSGGVVNMYHMKEDGWVKVESTDVSDLLHQYREANQ Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.