PRKRA (Protein Kinase, Interferon-Inducible Double Stranded RNA Dependent Activator, DYT16, HSD14, PACT, RAX)

Size

£685.00

SKU:: 250499
Purity:: Purified
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: PRKRA (NP_003681, 101aa-200aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1G12
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: This gene encodes a protein kinase activated by double-stranded RNA which mediates the effects of interferon in response to viral infection. Mutations in this gene have been associated with dystonia. Alternative splicing results in multiple transcript variants. [provided by RefSeq. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: ANASICFAVPDPLMPDPSKQPKNQLNPIGSLQELAIHHGWRLPEYTLSQEGGPAHKREYTTICRLESFMETGKGASKKQAKRNAAEKFLAKFSNISPENH Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.