250396-FITC
PPP1R2P3 (Protein Phosphatase 1, Regulatory (Inhibitor) Subunit 2 Pseudogene 3, MGC87149) (FITC)
Size
£914.00
- SKU:
- 250396-FITC
- Purity:
- Purified
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- PPP1R2P3 (AAH66922, 1aa-205aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 1H2
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
- Extra Details:
- Mouse monoclonal antibody raised against a full length recombinant PPP1R2P3. Applications: Suitable for use in Immunofluorescence, FLISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MAASTASHRPIKGILKNKTSTTSSMVASAEQPRRSVDEELSKKSQKWDEINILATYHPADKGYGLMKIDEPSPPYHSMMGDDEDACRDTETTEAMAPGILAKKLMouse monoclonal antibody raised against a full length recombinant PPP1R2P3.EGLEPKYRIQEQESSGEEDSDLSPEEREKKRQFEMRRKLHYNEGLNIKLARQLISKDLHDDDEDEEMLETADGESMNTEESNQGSTPSDQQQNKLRSS Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice