POU6F2 (POU Class 6 Homeobox 2, RPF-1, WT5, WTSL)

Size

£685.00

SKU:: 250328
Purity:: Purified
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: POU6F2 (NP_009183, 2aa-87aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1D3
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: POU6F2 is a member of a gene family characterized by the presence of a bipartite DNA-binding domain, consisting of a POU-specific domain and a POU heterodomain, separated by a variable polylinker. POU domain family members are transcriptional regulators, many of which show highly restricted patterns of expression and are known to control cell type-specific differentiation pathways (see review by Phillips and Luisi, 2000 [PubMed 11183772]).[supplied by OMIM Applications: Suitable for use in ELISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: IAGQVSKPLLSVRSEMNAELRGEDKAATSDSELNEPLLAPVESNDSEDTPSKLFGARGNPALSDPGTPDQHQASQTHPPFPVGPQP Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.